SKU: 65247296533

Human IFN-gamma, His Tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IFN-gamma, His TagProduct Specification Species Human Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution

Product Specification


Species Human
Accession P01579
Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH.
Expression System HEK293
Molecular Weight 18.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65247296533

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Maddisun wiles
Bozeman, US
★★★★★ 1
Disgusted!
Size: Small, Color: Black
I’m disgusted! I ordered this for my boyfriend to wear to prom. I ordered him a small and the jacket and the vest were not smalls, they look like they were a large. All three pieces had dog or cat hair on them and the jacket had dirt stains on the inside. They were all used! And some of the stitching was coming out! I’m so glad I received it the same day I bought it, because if received it closer to prom I would have been so screwed!!! Do not buy this or buy from this brand! Terrible product!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
S
Verified Purchase
spartan
Houston, US
★★★★★ 5
Dress to Impress: Sharp, Tailored Fit, Quality Material, and Sizing Tips
Size: X-Small, Color: Navy Blue, Size: X-Small, Color: Navy Blue
This review is for the LUPURTY Men's Suits Slim Fit, 3 Piece Suits for Men, 2 Buttons Solid Jacket Vest Pants, Tuxedo Set (XS navy blue and black sets). I bought the XS knowing my son's measurements were actually below the size guide for that size, but I'm glad I did because it still worked out. The suit was a bit big—especially in the pants, which were quite long, and slightly roomy in the shoulders and arms—but it still looked sharp and well put-together. The overall fit has a clean, tailored appearance despite the extra room. The material feels high-quality and the color is true to what’s shown online. I do wish the black suit came with a black or gray tie instead of blue, which didn’t quite match. The suit in the photos is the navy blue set that my son wore to his 8th grade graduation, which matched their school colors perfectly. I also included my son’s measurements to help others with sizing: Weight 114 lbs Height 5'3" Chest 30.5" Waist 29" Hip 35" Sleeve length 21.5" Shoulder 17" Inseam 29" Back length 18.5"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2025
J
Verified Purchase
Jyo
Pawtucket, US
★★★★★ 5
Perfect fit and nice material
Color: Blue, Size: Small
This is a really nice addition to my teen son's wardrobe because the cloth is great quality and it fits him perfectly. It looks good on him and holds up well, making it a very solid purchase for a teenager. We initially ordered the wrong size, but the exchange process was quick and prompt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
C
Verified Purchase
carrie
Phoenix, US
★★★★★ 5
Great purchase. Waist is a little big but it will work well.
Color: Light Brown, Size: Small, Color: Light Brown, Size: Small
Super fast one day shipping. The quality is good and the fit is good. He is 5 foot 11 and his waist is 30 inches. He has long arms and the jacket lands perfectly at his wrist. The pants were a little large in the waist and the length is a little long.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
K
Verified Purchase
K Rife
Cuba, US
★★★★★ 5
Fantastic suit, especially for the $$$!
Color: Black, Size: XX-Large
Bought this for my husband and my son to attend our daughter’s wedding as they had nothing to wear at all. I was kind of scared when I ordered 2 sets of these suits, I had read so many reviews that I was totally overwhelmed and didn’t know if I should get it or not, my head was literally spinning as the reviews were all over the place. So, we had went to Men’s Warehouse earlier in the day, so I had their suit jacket measurements, so I used those numbers, but tbh, I just went with the size that they usually get when getting clothes in general and their suits fit great! I was so relieved!! They looked so handsome oh my goodness! These suits fit the way that they are advertised to fit, which is “slim fit” which means they fit like a glove! Slim fit does not mean “too small” it means that these suits are not baggy or oversized, they fit the body just right! They were not wrinkly when taken out of the package, they were very nice quality, the pants were made with a nice material, they did not feel cheap at all. Everything was great!! I was so impressed with everything! I could not believe that I got both my husband and my son a 3 piece suit for less than $100 each! Both of them said that their suits were extremely comfortable and they had no problem wearing them all night. You could tell by their faces that they felt confident in them, and they knew they looked good. Very happy customer!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026

recommand products