SKU: 3002578329

CCoV N protein , His tag

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CCoV N protein , His tagProduct Specification Synonyms 5' nucleotidase (5' NT), Acid phosphatase 3, Ecto 5' nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP Accession Q7T6S8 Amino Acid Sequence Protein sequence(Q7T6S8, Met1 Asn382, with C 10*His)

Product Specification


Synonyms 5'-nucleotidase (5'-NT), Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP
Accession Q7T6S8
Amino Acid Sequence

Protein sequence(Q7T6S8, Met1-Asn382, with C-10*His)
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTNGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 45.1kDa Actual: 50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

The nucleocapsid (N) protein is a protein that packages the positive-sense RNA genome of coronaviruses to form ribonucleoprotein structures enclosed within the viral capsid. The N protein is the most highly expressed of the four major coronavirus structural proteins. In addition to its interactions with RNA, N forms protein-protein interactions with the coronavirus membrane protein (M) during the process of viral assembly. N also has additional functions in manipulating the cell cycle of the host cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3002578329

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bel Anne Craft Studio
Port Orchard, US
★★★★★ 5
Consistent, Vibrant Results That Match My Designs Perfectly
Color: 1BK/1C/1Y/1M
I’ve been consistently purchasing this Hiipoo sublimation ink for my sublimation printers, and I’ve been extremely pleased with the results. The print quality is excellent, with vibrant colors and clean transfers every time. What I really appreciate is how true the final product turns out compared to my original designs. The colors stay accurate, and the finished results look exactly the way I intended, which is very important for my projects and products. This ink has been reliable and consistent, and I will definitely continue using it for my sublimation work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Perfect to the job
Color: 1BK/1C/1Y/1M
No issues with this ink. Used it to turn a printer into sublimation printing and the ink is perfect and easy to fill.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
M
Verified Purchase
Monique Rodriguez
West Palm Beach, US
★★★★★ 5
Great for sublimation
Color: 1BK/1C/1Y/1M
Great for sublimation. Colors r vibrant and dries fast. Easy to install and is compatible with my epson peinter
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
A
Verified Purchase
Angela
Lexington, US
★★★★★ 5
Great quality, Great price
Color: 1BK/1C/1Y/1M
Excellent transfer and image quality. It really does work in an Epson Eco tank, as long as you never fill it with the Epson ink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
S
Verified Purchase
Sheena
Fort Morgan, US
★★★★★ 5
Love
Color: 1BK/1C/1Y/1M
Works very well. Color is on point. Worth the money. No clogs. No leaks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products